General Information

  • ID:  hor004581
  • Uniprot ID:  P21752(2-40)
  • Protein name:  Thymosin beta-8
  • Gene name:  TMSB10
  • Organism:  Bos taurus (Bovine)
  • Family:  Thymosin beta family
  • Source:  animal
  • Expression:  Distributed in numerous types of tissues, including thymus, spleen, lung, liver and muscle.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  ADKPDLGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQ
  • Length:  39(2-40)
  • Propeptide:  MADKPDLGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK
  • Signal peptide:  NA
  • Modification:  T1 N-acetylalanine;T3 N6-acetyllysine;T11 Phosphoserine;T14 N6-acetyllysine;T20 Phosphothreonine;T22 Phosphothreonine;T33 Phosphothreonine;T38 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton. May be involved in the regulation of structural plasticity in the CNS.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P21752-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004581_AF2.pdbhor004581_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 515297 Formula: C193H322N52O69
Absent amino acids: CHMRVWY Common amino acids: K
pI: 4.96 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -157.18 Boman Index: -12543
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.13
Instability Index: 3885.13 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  6952223
  • Title:  Thymosins Beta 8 and Beta 9: Two New Peptides Isolated From Calf Thymus Homologous to Thymosin Beta 4